MUC2 Antibody

Catalog Number: orb402450

Catalog Number	orb402450
Category	Antibodies
Description	MUC2 Antibody
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	IF, IHC
Reactivity	Human, Mouse, Rat
Isotype	Rabbit IgG
Immunogen	A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).
Concentration	Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Form/Appearance	Lyophilized
Conjugation	Unconjugated
UniProt ID	Q02817
Storage	Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Alternative names	Mucin-2; MUC-2; Intestinal mucin-2; MUC2; SMUC Read more...
Note	For research use only
Application notes	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Expiration Date	12 months from date of receipt.

IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of human ileum tissue.

IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of human colon organoid tissue.

IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of mouse ileum tissue.

IF analysis of MUC2 using anti-MUC2 antibody.MUC2 was detected in paraffin-embedded section of mouse ileum organoid tissue.

IF analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in paraffin-embedded section of human intestine cancer tissue.

IF analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in paraffin-embedded section of mouse intestine tissue.

IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of human colon cancer tissue.

IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of mouse colon tissue.

IHC analysis of MUC2 using anti-MUC2 antibody. MUC2 was detected in a paraffin-embedded section of rat colon tissue.