You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578069 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MUC1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human, Porcine |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 22kDa |
Target | MUC1 |
UniProt ID | Q7Z552 |
Protein Sequence | Synthetic peptide located within the following region: RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN |
NCBI | NP_001037855 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-MUC1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-MUC1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Sample Type: Human stomach, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
Sample Type: Pig stomach, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
WB Suggested Anti-MUC1 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.
ICC, IF, IHC-P, WB | |
Human, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating