You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578067 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MUC1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Goat, Mouse, Rabbit, Rat |
Reactivity | Human, Porcine |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MUC1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 122 kDa |
Target | MUC1 |
UniProt ID | Q7Z550 |
Protein Sequence | Synthetic peptide located within the following region: ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM |
NCBI | NP_001037857 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | EMA, MCD, PEM, PUM, KL-6, MAM6, MCKD, PEMT, CD227, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.
Host: Rabbit, Target Name: MUC1, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: Human stomach, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
Sample Type: Pig stomach, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: Brown: MUC1 Blue: Nucleus, Gene Name: MUC1.
WB Suggested Anti-MUC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. MUC1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ICC, IF, IHC-P, WB | |
Human, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating