You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579162 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MTUS1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MTUS1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 141kDa |
Target | MTUS1 |
UniProt ID | Q9ULD2 |
Protein Sequence | Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR |
NCBI | NP_001001924 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ATBP, ATIP, ICIS, MP44, ATIP3, MTSG1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: EGFL8, Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2.
Host: Rabbit, Target Name: GNAS, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: MTUS1, Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NSUN6, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
MTUS1 antibody - middle region (orb579162) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.
MTUS1 antibody - middle region (orb579162) validated by WB using MCF-7, HeLa, and human cancer cell lines at 1:2000.
Rabbit Anti-MTUS1 Antibody, Catalog Number: orb579162, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and membrane in cell bodies of pinealocytes and their processes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-MTUS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate. MTUS1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
ELISA, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating