You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578890 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MTTP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MTTP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 99 kDa |
Target | MTTP |
UniProt ID | P55157 |
Protein Sequence | Synthetic peptide located within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK |
NCBI | NP_000244 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ABL, MTP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: MTTP, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/ml.
WB Suggested Anti-MTTP Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. MTTP is supported by BioGPS gene expression data to be expressed in HepG2.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Monkey, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating