You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331138 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MTNR1A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Sheep |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 39kDa |
Target | MTNR1A |
UniProt ID | P48039 |
Protein Sequence | Synthetic peptide located within the following region: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV |
NCBI | NP_005949 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MEL-1A-R antibody, anti MT1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Jurkat Whole Cell tissue using MTNR1A antibody
Host: Rabbit, Target Name: HIRIP3, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-MTNR1A Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.
ELISA, ICC, IF, IHC-P, WB | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Canine, Gallus, Guinea pig, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating