MTNR1A antibody

• Catalog Number: orb331138
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MTNR1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Sheep
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: MTNR1A
• UniProt ID: P48039
• Protein Sequence: Synthetic peptide located within the following region: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV
• NCBI: NP_005949
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MEL-1A-R antibody, anti MT1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Jurkat Whole Cell tissue using MTNR1A antibody

Host: Rabbit, Target Name: HIRIP3, Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-MTNR1A Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.