MSX2 antibody

• Catalog Number: orb573780
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MSX2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human MSX2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: MSX2
• UniProt ID: P35548
• Protein Sequence: Synthetic peptide located within the following region: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE
• NCBI: NP_002440
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FPP, MSH, PFM, CRS2, HOX8, PFM1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: MSX2, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Sample Type: MCF7, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: MSX2.

WB Suggested Anti-MSX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.