You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389438 |
---|---|
Category | Antibodies |
Description | MRP1/ABCC1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 171591 MW |
UniProt ID | P33527 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Multidrug resistance-associated protein 1;ATP-bind Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of MRP1 using anti-MRP1 antibody.Lane 1:HELA cell;2:A549 cell.
IHC, WB | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating