You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381080 |
---|---|
Category | Antibodies |
Description | MPP1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF), different from the related mouse sequence by one amino acid. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 52296 MW |
UniProt ID | Q00013 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | 55 kDa erythrocyte membrane protein;p55;Membrane p Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U87 cells using anti-MPP1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of MPP1 using anti-MPP1 antibody.Lane 1:rat lung tissue; 2:mouse spleen tissue; 3:MCF-7 cell.
IF analysis of MPP1 using anti-MPP1 antibody. MPP1 was detected in immunocytochemical section of MCF7 cells.
Filter by Rating