MPG monoclonal antibody (M04), clone 1E10

• Catalog Number: orb2292584
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MPG.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E10
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA
• NCBI: AAH14991
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MPG is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MPG on HeLa cell. [antibody concentration 40 ug/ml]

Immunoperoxidase of monoclonal antibody to MPG on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]

MPG monoclonal antibody (M04), clone 1E10 Western Blot analysis of MPG expression in Hela S3 NE.

Western Blot analysis of MPG expression in transfected 293T cell line by MPG monoclonal antibody (M04), clone 1E10. Lane 1: MPG transfected lysate (32.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).