MPG Rabbit Polyclonal Antibody

• Catalog Number: orb579254
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MPG
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MPG
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 32kDa
• Target: MPG
• UniProt ID: Q5J9I4
• Protein Sequence: Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
• NCBI: NP_001015052
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AAG, MDG, ADPG, APNG, Mid1, anpg, PIG11, PIG16, CR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

MPG was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579254 with 1:200 dilution. Western blot was performed using orb579254 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: MPG IP with orb579254 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

WB Suggested Anti-MPG Antibody, Positive Control: Lane 1: 50 ug RCC4 lysate, Lane 2: 50 ug RCC4 lysate, Lane 3: 50 ug 786-0 lysate, Lane 4: 50 ug 786-0 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa 680, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-MPG Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.