You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579254 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MPG |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MPG |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 32kDa |
Target | MPG |
UniProt ID | Q5J9I4 |
Protein Sequence | Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA |
NCBI | NP_001015052 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | AAG, MDG, ADPG, APNG, Mid1, anpg, PIG11, PIG16, CR Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
MPG was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579254 with 1:200 dilution. Western blot was performed using orb579254 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: MPG IP with orb579254 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.
WB Suggested Anti-MPG Antibody, Positive Control: Lane 1: 50 ug RCC4 lysate, Lane 2: 50 ug RCC4 lysate, Lane 3: 50 ug 786-0 lysate, Lane 4: 50 ug 786-0 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa 680, Secondry Antibody Dilution: 1:5000.
WB Suggested Anti-MPG Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Filter by Rating