You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594885 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Tumor necrosis factor receptor superfamily member 14(Tnfrsf14),partial (Active) |
Tag | C-terminal Fc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 45.6 kDa |
UniProt ID | Q80WM9 |
Protein Sequence | QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined by its ability to bind Human BTLA in functional ELISA is typically 1.17 ug/ml |
Expression Region | 39-207aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Tnfrsf14; Herpesvirus entry mediator;HVEM; TR2;TNF Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
≥90% as determined by SDS-PAGE | |
This protein contains the mouse Tnfrsf14(Gln39-Val207) was fused with the C-terminal Fc Tag and expressed in Mammalian cells. |
Unconjugated | |
95% | |
44.2 kDa | |
Human HVEM, Mouse IgG2a Fc Tag (orb1496301) is expressed from human 293 cells (HEK293). It contains AA Leu 39 - Val 202 (Accession # Q92956-1). |
Filter by Rating