You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54123 |
---|---|
Category | Proteins |
Description | Recombinant mouse Tnf protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 35.7 kDa |
UniProt ID | P06804 |
Protein Sequence | GPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
Protein Length | Extracellular Domain |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 57-235aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Cachectin TNF-alpha Tumor necrosis factor ligand s Read more... |
Note | For research use only |
Application notes | N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged1-338AA: 57-235AAFull Length: Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
> 98% as determined by SDS-PAGE and HPLC. | |
17.4 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
16.4 kDa | |
E.coli |
Unconjugated | |
95% | |
19.1 kDa | |
Mouse TNF-alpha, His Tag (orb1496307) is expressed from human 293 cells (HEK293). It contains AA Leu 80 - Leu 235 (Accession # P06804). |
Filter by Rating