You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594765 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Transforming growth factor beta-1(Tgfb1) (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 12.8 kDa |
UniProt ID | P04202 |
Protein Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is less than 1 ng/ml. |
Expression Region | 279-390aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
Alternative names | TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
WB | |
Human, Mouse, Primate, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating