Mouse RANTES protein (Active)

• Catalog Number: orb359106
• Category: Proteins
• Description: Recombinant mouse RANTES active protein
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• MW: 7.9 kDa
• UniProt ID: P30882
• Protein Sequence: SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
• Protein Length: Full Length of Mature Protein
• Source: E.Coli
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T lymphocytes is in a concentration range of 1.0-10 ng/ml.
• Expression Region: 24-91aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA
• Alternative names: Beta chemokine RANTES protein, C C motif chemokine
• Background: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells. {ECO:0000250|UniProtKB:P13501}.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Mouse RANTES protein (Active)