Mouse PDGF B protein

• Catalog Number: orb594768
• Category: Proteins
• Description: Recombinant Mouse Platelet-derived growth factor subunit B(Pdgfb) (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 13.4 kDa
• UniProt ID: P31240
• Protein Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
• Protein Length: Full Length of Mature Protein
• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 40 ng/ml.
• Expression Region: 82-190aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 4 mM HCl
• Alternative names: Platelet-Derived Growth Factor Subunit B; PDGF Sub
• Note: For research use only
• Application notes: Full Length of Mature Protein
• Expiration Date: 6 months from date of receipt.