You have no items in your shopping cart.
Cart summary
Mouse PDGF B protein
Catalog Number: orb594768
| Catalog Number | orb594768 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Platelet-derived growth factor subunit B(Pdgfb) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 13.4 kDa |
| UniProt ID | AAH53430.1 |
| Protein Sequence | SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/c3T3 mouse fibroblast cells is 1.55 ng/ml. |
| Expression Region | 82-190aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
| Alternative names | Platelet-Derived Growth Factor Subunit B; PDGF Sub Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
Mouse PDGF B protein [orb707263]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 500 μg, 50 μgMouse PDGF BB Protein [orb429457]
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
2 μg, 10 μg, 1 mg
