You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb603963 |
---|---|
Category | Proteins |
Description | Recombinant Mouse C-C motif chemokine 2(Ccl2),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 12.4 kDa |
UniProt ID | P10148 |
Protein Sequence | QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 24-96aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | HC11Monocyte chemoattractant protein 1Monocyte che Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
FC, IHC-P | |
Canine, Equine, Mouse, Porcine, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating