You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594761 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Kit ligand(Kitlg),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 18.4 kDa |
UniProt ID | P20826 |
Protein Sequence | KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined by the dose-dependent stimulation of TF-1 cells is less than 10 ng/ml. |
Expression Region | 26-189aa |
Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | Kit ligand;Hematopoietic growth factor KL;Mast cel Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
19.5 kDa | |
Mouse SCF, His Tag (orb257825) is expressed from human 293 cells (HEK293). It contains AA Lys 26 - Ala 189 (Accession # NP_038626). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
> 95% by SDS-PAGE. | |
KMP1711, Recombinant Mouse SCF Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys26-Ala189) of mouse SCF (Accession #NP_038626.1.) fused with a 6×His Tag at the C-terminus. |
≥90% as determined by SDS-PAGE | |
This protein contains the mouse Kitlg(Lys26-Ala189) was fused without Tag and expressed in E. coli. |
Filter by Rating