You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594833 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-7(Il7) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 15.9 kDa |
UniProt ID | P10168 |
Protein Sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is less than 5 ng/ml. |
Expression Region | 26-154aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoi Read more... |
Background | Mouse interleukin-7(IL-7) is the member of hemopoietin family which is important to the differentiation, proliferation, and survival of lymphocyte. Mouse IL-7 shares approximately 88% aa sequence identity with rat IL-7 and 58-60% with human, equine, bovine, ovine, porcine, feline and canine IL-7. It is widely expressed in primary and secondary lymphoid tissues cell and stromal epithelial cells of the thymus, bone marrow, and intestines. IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. It is important for proliferation during certain stages of B-cell maturation. IL-7 contributes to the maintenance of all naïve and memory T cells, mainly by promoting expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interaction |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 96% as determined by SDS-PAGE and HPLC. | |
14.9 kDa | |
E.Coli |
Unconjugated | |
90% | |
16.8 kDa | |
Mouse IL-7, His Tag (orb1496304) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ile 154 (Accession # Q544C8). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
35.5 kDa | |
E.Coli |
Filter by Rating