You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Il7 protein
Catalog Number: orb594833
| Catalog Number | orb594833 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Interleukin-7(Il7) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 15.9 kDa |
| UniProt ID | P10168 |
| Protein Sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
| Protein Length | Full Length of Mature Protein |
| Source | Mammalian cell |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml. |
| Expression Region | 26-154aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoi Read more... |
| Background | Mouse interleukin-7(IL-7) is the member of hemopoietin family which is important to the differentiation, proliferation, and survival of lymphocyte. Mouse IL-7 shares approximately 88% aa sequence identity with rat IL-7 and 58-60% with human, equine, bovine, ovine, porcine, feline and canine IL-7. It is widely expressed in primary and secondary lymphoid tissues cell and stromal epithelial cells of the thymus, bone marrow, and intestines. IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. It is important for proliferation during certain stages of B-cell maturation. IL-7 contributes to the maintenance of all naïve and memory T cells, mainly by promoting expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interaction |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse IL7 protein (Active) [orb359013]
> 96% as determined by SDS-PAGE and HPLC.
14.9 kDa
E.Coli
100 μg, 500 μg, 10 μg - Item 1 of 1
Mouse IL-7 Protein [orb1496304]
Unconjugated
90%
16.8 kDa
Mouse IL-7, His Tag (orb1496304) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ile 154 (Accession # Q544C8).
50 μg, 1 mg 
Mouse IL7 protein [orb707241]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
50 μg, 500 μg, 10 μgIL-7 Protein, Human, Recombinant (His) [orb1962154]
> 99.9%
19-30 KDa (reducing condition)
1 mg, 10 μg, 50 μg, 500 μg
