You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594835 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-4(Il4),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 13.4 kDa |
UniProt ID | P07750 |
Protein Sequence | HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using CTLL‑2 mouse cytotoxic T cells is less than 0.01 ng/ml. |
Expression Region | 23-140aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5. |
Alternative names | Interleukin-4;B-cell IgG differentiation factor;B- Read more... |
Background | Mouse Interleukin-4(IL-4) is a monomeric, Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four αhelix structure. IL4 exerts its effects through two receptor complexes, Participates in at least several B-cell activation processes as well as of other cell types. IL4 is primarily expressed by Th2biased CD4+T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG1 and IgE in mouse B cells, acquisition of the Th2 phenotype by naïve CD4+T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL4 plays a dominant role in the development of allergic inflammation and asthma. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and mon |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
13.5 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
14.6 kDa | |
Mammalian cell |
Unconjugated | |
95% | |
15.4 kDa | |
Mouse IL-4, His Tag (orb1149287) is expressed from human 293 cells (HEK293). It contains AA His 21 - Ser 140 (Accession # P07750-1). |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating