You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359010 |
---|---|
Category | Proteins |
Description | Recombinant mouse IL4 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 97% as determined by SDS-PAGE and HPLC. |
MW | 13.5 kDa |
UniProt ID | P07750 |
Protein Sequence | M+HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant prolifiration of Murine HT-2 cells is less then 2 ng/ml, corresponding to a Specific Activity of > 5 × 105 IU/mg. |
Expression Region | 21-140aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered , PBS, pH 7.4 |
Alternative names | B cell growth factor 1 protein, B cell IgG differe Read more... |
Background | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Mouse IL4 protein (Active)
Greater than 95% as determined by SDS-PAGE. | |
13.4 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
14.6 kDa | |
Mammalian cell |
Filter by Rating