Cart summary

You have no items in your shopping cart.

    Mouse IL4 protein (Active)

    Catalog Number: orb359010

    DispatchUsually dispatched within 1-2 weeks
    $ 2,754.00
    Catalog Numberorb359010
    CategoryProteins
    DescriptionRecombinant mouse IL4 active protein
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 97% as determined by SDS-PAGE and HPLC.
    MW13.5 kDa
    UniProt IDP07750
    Protein SequenceM+HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
    Protein LengthFull Length of Mature Protein
    SourceE.Coli
    Biological OriginMus musculus (Mouse)
    Biological ActivityFully biologically active when compared to standard. The ED50 as determined by the dose-dependant prolifiration of Murine HT-2 cells is less then 2 ng/ml, corresponding to a Specific Activity of > 5 × 105 IU/mg.
    Expression Region21-140aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 µm filtered , PBS, pH 7.4
    Alternative namesB cell growth factor 1 protein, B cell IgG differe
    Read more...
    BackgroundParticipates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Mouse IL4 protein (Active)

    SDS-PAGE analysis of Mouse IL4 protein (Active)

    Mouse IL4 protein (Active)

    • Mouse IL4 protein [orb594835]

      Greater than 95% as determined by SDS-PAGE.

      13.4 kDa

      E.coli

      500 μg, 1 mg, 10 μg, 50 μg
    • Mouse IL4 protein [orb594837]

      Greater than 95% as determined by SDS-PAGE.

      14.6 kDa

      Mammalian cell

      500 μg, 1 mg, 10 μg, 50 μg
    • Recombinant Mouse Interleukin-4 protein(Il4) (Active) [orb1650627]

      5 μg, 20 μg, 100 μg, 250 μg, 500 μg, 1 mg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars