Mouse IL36G protein

• Catalog Number: orb419313
• Category: Proteins
• Description: Recombinant Mouse Interleukin-36 gamma active
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 98% as determined by SDS-PAGE and HPLC.
• MW: 17.3 kDa
• UniProt ID: Q8R460
• Protein Sequence: GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS
• Protein Length: Full Length of Mature Protein
• Source: E.Coli
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of ＞ 1.0 × 105 IU/mg.
• Expression Region: 13-164aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20
• Alternative names: Interleukin-1 family member 9,
• Background: Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP (By similarity). Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in proinflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of proinflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4(+) T cells and splenocytes. {ECO:0000250|UniProtKB:Q9NZH8, ECO:0000269|PubMed:21860022, ECO:0000269|PubMed:21965679}.
• Note: For research use only
• Application notes: Tag Info: NO-taggedExpression Region: 13-164aaSequence Info: Full Length of Mature Protein
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Mouse IL36G protein