You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594779 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Interleukin-33(Il33),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 17.6 kDa |
UniProt ID | Q8BVZ5 |
Protein Sequence | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The activity is as determined by its binding ability in a functional ELISA. Immobilized recombinant mouse IL33 at 5 μg/mL can bind mouse IL1RL1 with a linear range of 0.625-5ug/ml. |
Expression Region | 109-266aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Inter Read more... |
Background | Mouse Interleukin 33 (IL-33) is a 30 kDa proinflammatory cytokine which may also regulates gene transcription in producer cells. IL-33 is constitutively expressed in smooth muscle and airway epithelia. IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. It is up‑regulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL-1 alpha or IL‑1 beta stimulation. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and also leads to severe pathological changes in mucosal org |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 98% as determined by SDS-PAGE and HPLC. | |
17.5 kDa | |
E.Coli |
Unconjugated | |
90% | |
19.5 kDa | |
Mouse IL-33, His Tag (orb750372) is expressed from human 293 cells (HEK293). It contains AA Ser 109 - Ile 266 (Accession # Q8BVZ5-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
FA, HPLC, SDS-PAGE | |
Unconjugated | |
> 97.0% as determined by RP-HPLC and analysis by SDS-PAGE |
Filter by Rating