You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359021 |
---|---|
Category | Proteins |
Description | Recombinant mouse IL33 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 98% as determined by SDS-PAGE and HPLC. |
MW | 17.5 kDa |
UniProt ID | Q8BVZ5 |
Protein Sequence | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Protein Length | Partial |
Source | E.Coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg. |
Expression Region | 109-266aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, and 1 mM EDTA |
Alternative names | IL-33,; Interleukin-33109-266,] Read more... |
Background | Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Mouse IL33 protein (Active)
Greater than 95% as determined by SDS-PAGE. | |
17.6 kDa | |
E.coli |
Filter by Rating