You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54701 |
---|---|
Category | Proteins |
Description | Recombinant mouse Il23a protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 23.7 kDa |
UniProt ID | Q9EQ14 |
Protein Sequence | VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA |
Protein Length | Full Length of Mature Protein |
Source | in vitro E.coli expression system |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 22-196aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Interleukin-23 subunit p19 Short name, IL-23p19 Read more... |
Note | For research use only |
Application notes | N-terminal 6xHis-B2M-tagged: N-terminal 6xHis-tagged1-431AA: 22-196AAFull Length of Isoform 2: Full Length |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 45.8 kDa after removal of the signal peptide. | |
Mammalian |
≥90% as determined by SDS-PAGE | |
This protein contains the mouse Il23a(Val22-Ala196&Met23-Ser335) was fused without Tag and expressed in Mammalian cells. |
Filter by Rating