You have no items in your shopping cart.
Cart summary
Mouse Il1b protein
Catalog Number: orb245676
| Catalog Number | orb245676 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Interleukin-1 beta protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 21.2 kDa |
| UniProt ID | P10749 |
| Protein Sequence | PIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 119-268aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Il1b Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Mouse IL1B protein (Active) [orb359006]
> 96% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Mouse IL-1 beta Protein, His Tag [orb762425]
Unconjugated
95%
19.3 kDa
Mouse IL-1 beta, His Tag (orb762425) is expressed from E. coli cells. It contains AA Val 118 - Ser 269 (Accession # P10749-1).
20 μg, 50 μg - Item 1 of 1
Recombinant mouse IL-1b protein, C-His [orb1516852]
> 95% as determined by SDS-PAGE
26 kDa
500 μg, 100 μg Mouse IL1B protein [orb391946]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μg
