Mouse Il1b protein

Catalog Number: orb245676

Catalog Number	orb245676
Category	Proteins
Description	Recombinant mouse Interleukin-1 beta protein
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	21.2 kDa
UniProt ID	P10749
Protein Sequence	PIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS
Protein Length	Partial
Source	E.coli
Biological Origin	Mus musculus (Mouse)
Expression Region	119-268aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Il1b Read more...
Note	For research use only
Application notes	This is His-tag protein
Expiration Date	6 months from date of receipt.

Purity:	> 96% as determined by SDS-PAGE and HPLC.
MW:	17.5 kDa
Source:	E.Coli

Conjugation:	Unconjugated
Purity:	95%
MW:	19.3 kDa
Source:	Mouse IL-1 beta, His Tag (orb762425) is expressed from E. coli cells. It contains AA Val 118 - Ser 269 (Accession # P10749-1).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the mouse Il1b(Val118-Ser269) was fused without Tag and expressed in E. coli.