Mouse Il18 protein

Catalog Number: orb604186

Catalog Number	orb604186
Category	Proteins
Description	Recombinant Mouse Interleukin-18 (Il18)
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 85% as determined by SDS-PAGE.
MW	26.1 kDa
UniProt ID	P70380
Protein Sequence	MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Protein Length	Full Length
Source	E.coli
Biological Origin	Mus musculus (Mouse)
Expression Region	1-192aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Interferon gamma-inducing factor (IFN-gamma-induci Read more...
Note	For research use only
Application notes	Full Length
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 44.3 kDa after removal of the signal peptide.The apparent molecular mass of IL18-mFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 100 μg, 50 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	E. coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	24.1 kDa
Source:	Yeast