Mouse Il17a protein

• Catalog Number: orb594832
• Category: Proteins
• Description: Recombinant Mouse Interleukin-17A(Il17a),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 16.2 kDa
• UniProt ID: Q62386
• Protein Sequence: TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells is less than 200 ng/ml.
• Expression Region: 22-158aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4.
• Alternative names: Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lympho
• Background: Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. Mature mouse IL-17A shares 61% and 89% amino acid sequence identity with human and rat IL-17A, respectively. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.