You have no items in your shopping cart.
Cart summary
Mouse IL15RA protein
Catalog Number: orb594834
| Catalog Number | orb594834 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse IL15RA Protein. |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 45.5 kDa |
| UniProt ID | Q60819 |
| Protein Sequence | GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is 0.5-2 ng/ml. |
| Expression Region | 33-205aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alternative names | Interleukin-15 receptor subunit alpha;Il15ra;sIL-1 Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Mouse IL-15 R alpha Protein, Fc Tag [orb867324]
Unconjugated
90%
44.8 kDa
Mouse IL-15 R alpha, Fc Tag (orb867324) is expressed from human 293 cells (HEK293). It contains AA Gly 33 - Lys 205 (Accession # Q60819-1).
100 μg, 1 mg Mouse IL15RA protein [orb391926]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
50 μg, 10 μg, 500 μgIL-15RA Protein, Mouse, Recombinant (hFc, Human Cells) [orb1962071]
> 99.9%
60-90 KDa (reducing condition)
10 μg, 20 μg, 50 μgRecombinant Mouse IL-15RA/IL-15 R alpha Protein, Fc His Tag [orb1550830]
> 95% by SDS-PAGE.
Recombinant Mouse IL-15RA/IL-15 R alpha Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gly33-Lys205) of mouse IL-15RA/IL-15 R alpha (Accession #Q60819) fused with an Fc tag at the C-terminus.
50 μg
