You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse IL13 protein
Catalog Number: orb594831
| Catalog Number | orb594831 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Interleukin-13(Il13),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 11.7 kDa |
| UniProt ID | P20109 |
| Protein Sequence | SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 1.93 ng/ml. |
| Expression Region | 26-131aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | Interleukin-13; IL-13; T-Cell Activation Protein P Read more... |
| Background | Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Rα1 with low affinity and triggers association of IL4Rα, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Rα2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disea |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse IL13 protein [orb594829]
Greater than 95% as determined by SDS-PAGE.
13.1 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Mouse IL13 protein [orb594830]
Greater than 95% as determined by SDS-PAGE.
12.7 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Mouse IL13 protein (Active) [orb359017]
> 97% as determined by SDS-PAGE and HPLC.
12.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Mouse IL-13 Protein [orb1176550]
Unconjugated
90%
14.2 kDa
Mouse IL-13, His Tag (orb1176550) is expressed from human 293 cells (HEK293). It contains AA Ala 19 - Phe 131 (Accession # P20109-1).
500 μg, 50 μg 
