Cart summary

You have no items in your shopping cart.

    Mouse IL13 protein (Active)

    Catalog Number: orb359017

    DispatchUsually dispatched within 1-2 weeks
    $ 4,390.00
    Catalog Numberorb359017
    CategoryProteins
    DescriptionRecombinant mouse IL13 active protein
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 97% as determined by SDS-PAGE and HPLC.
    MW12.3 kDa
    UniProt IDP20109
    Protein SequenceM+PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
    Protein LengthPartial
    SourceE.Coli
    Biological OriginMus musculus (Mouse)
    Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 4 ng/ml, corresponding to a specific activity of > 2.5 × 105 IU/mg.
    Expression RegionM+22-131aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
    Alternative namesAllergic rhinitis protein, ALRH protein, BHR 1 pro
    Read more...
    BackgroundCytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). {ECO:0000250}.
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Mouse IL13 protein (Active)

    SDS-PAGE analysis of Mouse IL13 protein (Active)

    Mouse IL13 protein (Active)

    • Mouse IL13 protein [orb594829]

      Greater than 95% as determined by SDS-PAGE.

      13.1 kDa

      Mammalian cell

      500 μg, 1 mg, 10 μg, 50 μg
    • Mouse IL13 protein [orb594830]

      Greater than 95% as determined by SDS-PAGE.

      12.7 kDa

      Mammalian cell

      500 μg, 1 mg, 10 μg, 50 μg
    • Mouse IL13 protein [orb594831]

      Greater than 95% as determined by SDS-PAGE.

      11.7 kDa

      E.coli

      10 μg, 500 μg, 1 mg, 50 μg
    • Recombinant Mouse Interleukin-13 protein(Il13) (Active) [orb1650670]

      1 mg, 10 μg, 100 μg, 250 μg, 500 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars