Mouse IL11 protein (Active)

• Catalog Number: orb359016
• Category: Proteins
• Description: Recombinant mouse IL11 active protein
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• MW: 19.1 kDa
• UniProt ID: P47873
• Protein Sequence: M+PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
• Protein Length: Full Length of Mature Protein
• Source: E.Coli
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine T11 cells is less than 2 ng/ml, corresponding to a specific activity of ＞ 5.0 × 105 IU/mg.
• Expression Region: 22-199aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Alternative names: IL-11,
• Background: Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production (PubMed:8913282). Also promotes the proliferation of hepatocytes in response to liver damage (PubMed:22253262). Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation, also in the context of various cancers (PubMed:10026196, PubMed:23948300). Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3 (PubMed:23948300, PubMed:22253262). {ECO:0000269|PubMed:10026196, ECO:0000269|PubMed:22253262, ECO:0000269|PubMed:23948300, ECO:0000269|PubMed:8913282}.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.

SDS-PAGE analysis of Mouse IL11 protein (Active)