Cart summary

You have no items in your shopping cart.

Mouse IL11 protein (Active)

Catalog Number: orb359016

DispatchUsually dispatched within 1-2 weeks
$ 400.00
Catalog Numberorb359016
CategoryProteins
DescriptionRecombinant mouse IL11 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Purity> 97% as determined by SDS-PAGE and HPLC.
MW19.1 kDa
UniProt IDP47873
Protein SequenceM+PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Protein LengthFull Length of Mature Protein
SourceE.Coli
Biological OriginMus musculus (Mouse)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine T11 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg.
Expression Region22-199aa
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Alternative namesIL-11,
Read more...
NoteFor research use only
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date6 months from date of receipt.
Mouse IL11 protein (Active)