You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820745 |
---|---|
Category | Proteins |
Description | The Mouse IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-17A Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: AAIIPQSSAC PNTEAKDFLQ NVKVNLKVFN SLGAKVSSRR PSDYLNRSTS PWTLHRNEDP DRYPSVIWEA QCRHQRCVNA EGKLDHHMNS VLIQQEILVL KREPESCPFT FRVEKMLVGV GCTCVASIVR QAA (133)) (Gene ID: 16171). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 15.0 kDa |
Target | IL-17A |
Entrez | 16171 |
Protein Sequence | AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA (133) |
Protein Length | 133 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 95% as determined by SDS-PAGE. | |
16.2 kDa | |
Mammalian cell |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Filter by Rating