You have no items in your shopping cart.
Cart summary
Mouse IL-17A protein
Catalog Number: orb1216267
| Catalog Number | orb1216267 |
|---|---|
| Category | Proteins |
| Description | The Mouse IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-17A Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: AAIIPQSSAC PNTEAKDFLQ NVKVNLKVFN SLGAKVSSRR PSDYLNRSTS PWTLHRNEDP DRYPSVIWEA QCRHQRCVNA EGKLDHHMNS VLIQQEILVL KREPESCPFT FRVEKMLVGV GCTCVASIVR QAA (133)) (Gene ID: 16171). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 15.0 kDa |
| Target | IL-17A |
| Entrez | 16171 |
| Protein Sequence | AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA (133) |
| Protein Length | 133 |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Mouse Il17a protein [orb594832]
Greater than 95% as determined by SDS-PAGE.
16.2 kDa
Mammalian cell
500 μg, 1 mg, 10 μg, 50 μg - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
