Mouse IL-10 protein

Catalog Number: orb1216249

Catalog Number	orb1216249
Category	Proteins
Description	The Mouse IL-10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-10 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-10 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-10 Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)) (Gene ID: 16153).
Form/Appearance	Lyophilized
Purity	98%
MW	18.8 kDa
Target	IL-10
Entrez	16153
Protein Sequence	SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)
Protein Length	160
Source	Yeast
Storage	-20°C
Note	For research use only
Expiration Date	6 months from date of receipt.

Purity:	> 97% as determined by SDS-PAGE and HPLC.
MW:	18.7 kDa
Source:	E.Coli

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	18.9 kDa
Source:	E.coli

Conjugation:	Unconjugated
Purity:	92%
MW:	19.6 kDa
Source:	Mouse IL-10, His Tag (orb334904) is expressed from human 293 cells (HEK293). It contains AA Ser 19 - Ser 178 (Accession # NP_034678).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells