You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216249 |
---|---|
Category | Proteins |
Description | The Mouse IL-10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-10 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-10 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-10 Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)) (Gene ID: 16153). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 18.8 kDa |
Target | IL-10 |
Entrez | 16153 |
Protein Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160) |
Protein Length | 160 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
18.7 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
18.9 kDa | |
E.coli |
Unconjugated | |
92% | |
19.6 kDa | |
Mouse IL-10, His Tag (orb334904) is expressed from human 293 cells (HEK293). It contains AA Ser 19 - Ser 178 (Accession # NP_034678). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
HPLC, SDS-PAGE | |
Unconjugated | |
> 96 % by SDS-PAGE and HPLC analyses. | |
16.6 kDa |
Filter by Rating