You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594767 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Fibroblast growth factor 9(Fgf9) (Active) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 24.4 kDa |
UniProt ID | P54130 |
Protein Sequence | MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Protein Length | Full Length |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 10 ng/ml. |
Expression Region | 1-208aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5 |
Alternative names | Fibroblast growth factor 9;FGF-9;Glia-activating f Read more... |
Note | For research use only |
Application notes | Full Length |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
23.4 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
22.6 kDa | |
E.Coli |
Filter by Rating