Mouse Fgf2 protein

Catalog Number: orb594760

Catalog Number	orb594760
Category	Proteins
Description	Recombinant Mouse Fibroblast growth factor 2(Fgf2) (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	17.15 kDa
UniProt ID	P15655
Protein Sequence	MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Protein Length	Full Length
Source	E.coli
Biological Origin	Mus musculus (Mouse)
Biological Activity	The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 2 ng/ml.
Expression Region	1-154aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0
Alternative names	Fibroblast Growth Factor 2; FGF-2; Basic Fibroblas Read more...
Note	For research use only
Application notes	Full Length
Expiration Date	6 months from date of receipt.

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	18.9 kDa
Source:	Yeast

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	20.3 kDa
Source:	E.coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the mouse Fgf2(Met1-Ser154) was fused without Tag and expressed in E. coli.