Mouse Egf protein

• Catalog Number: orb594763
• Category: Proteins
• Description: Recombinant Mouse Pro-epidermal growth factor(Egf),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 7.2 kDa
• UniProt ID: P01132
• Protein Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
• Protein Length: Partial
• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5 ng/ml.
• Expression Region: 977-1029aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Alternative names: Pro-epidermal growth factor; Epidermal growth fact
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.