You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359272 |
---|---|
Category | Proteins |
Description | Recombinant mouse DHH active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 98% as determined by SDSPAGE and HPLC. |
MW | 20.0 kDa |
UniProt ID | Q61488 |
Protein Sequence | IIGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG |
Protein Length | Partial |
Source | E.Coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by murine MC3T3E1 cells is 520 μg/ml. |
Expression Region | 24-198aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.4,1 mM DTT, 0.05 % Tween-80 |
Alternative names | DHH, Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Mouse DHH protein (Active)
20.1 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |
20 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |
20 kDa, observed by non-reducing SDS-PAGE. | |
CHO |
Filter by Rating