You have no items in your shopping cart.
Cart summary
Mouse CXCL12 protein
Catalog Number: orb1216244
| Catalog Number | orb1216244 |
|---|---|
| Category | Proteins |
| Description | The Mouse CXCL12 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse CXCL12 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse CXCL12 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse CXCL12 Specifications: (Molecular Weight: 11.6 kDa) (Amino Acid Sequence: GKPVSLSYRC PCRFFESHIA RANVKHLKIL NTPNCALQIV ARLKNNNRQV CIDPKLKWIQ EYLEKALNKG RREEKVGKKE KIGKKKRQKK RKAAQKRKN (99)) (Gene ID: 20315). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 11.6 kDa |
| Target | CXCL12 |
| Entrez | 20315 |
| Protein Sequence | GKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN (99) |
| Protein Length | 99 |
| Source | Yeast |
| Storage | -20°C |
| Alternative names | IL-8 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Mouse SDF1 protein (Active) [orb359099]
> 97% as determined by SDS-PAGE and HPLC.
8.0 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 2
Mouse SDF1 protein (Active) [orb359100]
> 97% as determined by SDS-PAGE and HPLC.
8.5 kDa
E.Coli
10 μg, 100 μg, 500 μg Mouse SDF-1 α/SDF1A ELISA Kit [orb409141]
Mouse
0.156 ng/mL-10 ng/mL
0.039 ng/mL
10 x 96 t, 5 x 96 t, 96 t, 48 t, 24TMouse SDF1 ELISA Kit [orb409142]
Mouse
31.25 pg/mL-2000 pg/mL
7.81 pg/mL
10 x 96 t, 5 x 96 t, 96 t, 48 t, 24T
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
