You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216244 |
---|---|
Category | Proteins |
Description | The Mouse CXCL12 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse CXCL12 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse CXCL12 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse CXCL12 Specifications: (Molecular Weight: 11.6 kDa) (Amino Acid Sequence: GKPVSLSYRC PCRFFESHIA RANVKHLKIL NTPNCALQIV ARLKNNNRQV CIDPKLKWIQ EYLEKALNKG RREEKVGKKE KIGKKKRQKK RKAAQKRKN (99)) (Gene ID: 20315). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 11.6 kDa |
Target | CXCL12 |
Entrez | 20315 |
Protein Sequence | GKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN (99) |
Protein Length | 99 |
Source | Yeast |
Storage | -20°C |
Alternative names | IL-8 Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
8.0 kDa | |
E.Coli |
> 97% as determined by SDS-PAGE and HPLC. | |
8.5 kDa | |
E.Coli |
Mouse | |
0.156 ng/mL-10 ng/mL | |
0.039 ng/mL |
Mouse | |
31.25 pg/mL-2000 pg/mL | |
7.81 pg/mL |
Filter by Rating