You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594884 |
---|---|
Category | Proteins |
Description | Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 14.6 kDa |
UniProt ID | P09793 |
Protein Sequence | AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/ml. |
Expression Region | 37-161aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Alternative names | Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymp Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Filter by Rating