Cart summary

You have no items in your shopping cart.

    Mouse CSF2 protein (Active)

    Catalog Number: orb359038

    DispatchUsually dispatched within 1-2 weeks
    $ 2,754.00
    Catalog Numberorb359038
    CategoryProteins
    DescriptionRecombinant mouse CSF2 active protein
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 98% as determined by SDS-PAGE and HPLC.
    MW14.1 kDa
    UniProt IDP01587
    Protein SequenceAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFE QGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKK PGQK
    Protein LengthFull Length of Mature Protein
    SourceE.Coli
    Biological OriginMus musculus (Mouse)
    Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine FDC-P1 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg.
    Expression Region18-141aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 μm filtered PBS, pH 7.4
    Alternative namesGM-CSF, CSF
    Read more...
    BackgroundCytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
    NoteFor research use only
    Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
    Expiration Date6 months from date of receipt.
    Mouse CSF2 protein (Active)

    SDS-PAGE analysis of Mouse CSF2 protein (Active)

    Mouse CSF2 protein (Active)

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars