You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb359115 |
---|---|
Category | Proteins |
Description | Recombinant mouse CCL20 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 96% as determined by SDS-PAGE and HPLC. |
MW | 8.0 kDa |
UniProt ID | O89093 |
Protein Sequence | ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Biological Origin | Mus musculus (Mouse) |
Biological Activity | Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human CCR6 transfected murine BaF3 cells is in a concentration range of 0.1-10 ng/ml. |
Expression Region | 28-97aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Alternative names | Beta-chemokine exodus-1, CC chemokine ST38, Liver Read more... |
Background | Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. {ECO:0000250}. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Mouse CCL20 protein (Active)
Filter by Rating