You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1820693 |
---|---|
Category | Proteins |
Description | The Mouse BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse BAFF applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Mouse BAFF Specifications: (Molecular Weight: 20.6 kDa) (Amino Acid Sequence: AFQGPEETEQ DVDLSAPPAP CLPGCRHSQH DDNGMNLRNI IQDCLQLIAD SDTPTIRKGT YTFVPWLLSF KRGNALEEKE NKIVVRQTGY FFIYSQVLYT DPIFAMGHVI QRKKVHVFGD ELSLVTLFRC IQNMPKTLPN NSCYSAGIAR LEEGDEIQLA IPRENAQISR NGDDTFFGAL KLL (183)) (Gene ID: 24099). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 20.6 kDa |
Target | BAFF |
Entrez | 24099 |
Protein Sequence | AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL (183) |
Protein Length | 183 |
Source | Yeast |
Storage | -20°C |
Alternative names | TNFSF13B Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 46.8 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mBAFF is approximately 40-55 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 33.6 kDa after removal of the signal peptide.The apparent molecular mass of BAFF-R-mFc is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
Filter by Rating