Mouse BAFF Recombinant Protein

Catalog Number: orb1820693

Catalog Number	orb1820693
Category	Proteins
Description	The Mouse BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse BAFF applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Mouse BAFF Specifications: (Molecular Weight: 20.6 kDa) (Amino Acid Sequence: AFQGPEETEQ DVDLSAPPAP CLPGCRHSQH DDNGMNLRNI IQDCLQLIAD SDTPTIRKGT YTFVPWLLSF KRGNALEEKE NKIVVRQTGY FFIYSQVLYT DPIFAMGHVI QRKKVHVFGD ELSLVTLFRC IQNMPKTLPN NSCYSAGIAR LEEGDEIQLA IPRENAQISR NGDDTFFGAL KLL (183)) (Gene ID: 24099).
Form/Appearance	Lyophilized
Purity	98%
MW	20.6 kDa
Target	BAFF
Entrez	24099
Protein Sequence	AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL (183)
Protein Length	183
Source	Yeast
Storage	-20°C
Alternative names	TNFSF13B Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 46.8 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mBAFF is approximately 40-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 100 μg, 10 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 33.6 kDa after removal of the signal peptide.The apparent molecular mass of BAFF-R-mFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 50 μg, 100 μg