Mouse APRIL protein

Catalog Number: orb1216262

Catalog Number	orb1216262
Category	Proteins
Description	The Mouse APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Mouse APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 69583).
Form/Appearance	Lyophilized
Purity	98%
MW	16.4 kDa
Target	APRIL
Entrez	69583
Protein Sequence	AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)
Protein Length	146
Source	Yeast
Storage	-20°C
Alternative names	TNFSF13 Read more...
Note	For research use only
Expiration Date	6 months from date of receipt.