You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1819774 |
---|---|
Category | Proteins |
Description | The Mouse Annexin V yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse Annexin V applications are for cell culture, ELISA standard, and Western Blot Control. Mouse Annexin V yeast-derived recombinant protein can be purchased in multiple sizes. Mouse Annexin V Specifications: (Molecular Weight: 35.8 kDa) (Amino Acid Sequence: MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD (319)) (Gene ID: 11747). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 35.8 kDa |
Target | Annexin |
Entrez | 11747 |
Protein Sequence | MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD (319) |
Protein Length | 319 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 95% as determined by SDS-PAGE. | |
43.2 | |
E.coli |
Filter by Rating