You have no items in your shopping cart.
Cart summary
Mouse Angpt2 protein
Catalog Number: orb245668
| Catalog Number | orb245668 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Angiopoietin-2 |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 57 kDa |
| UniProt ID | O35608 |
| Protein Sequence | YSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYS |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 19-483aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Angpt2 Agpt2 Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Recombinant mouse Angiopoietin 2 protein, N-His [orb1808135]
> 90% as determined by SDS-PAGE
28.7 kDa
500 μg, 100 μg Mouse ANGPT2 Protein, His Tag [orb2699286]
> 95%, determined by SDS-PAGE
This protein contains the mouse ANGPT2 (NP_0314522) (Lys275-Phe496) was expressed with a N-terminal polyhistidine tag and expressed from HEK293 Cells.
20 μg, 50 μgANGPT2/Angiopoietin-2 Protein, Mouse, Recombinant (His) [orb1957205]
96.10%
27.5 kDa (predicted); 33.4 kDa (reducing conditions)
50 μg, 100 μgMouse Angiopoietin-2 Protein, His Tag [orb759210]
Unconjugated
90%
56.5 kDa
Mouse Angiopoietin-2, His Tag (orb759210) is expressed from human 293 cells (HEK293). It contains AA Tyr 19 - Phe 496 (Accession # O35608-1).
100 μg, 500 μg
