You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245668 |
---|---|
Category | Proteins |
Description | Recombinant mouse Angiopoietin-2 |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 57 kDa |
UniProt ID | O35608 |
Protein Sequence | YSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYS |
Protein Length | Partial |
Source | E.coli |
Biological Origin | Mus musculus (Mouse) |
Expression Region | 19-483aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Angpt2 Agpt2 Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
> 90% as determined by SDS-PAGE | |
28.7 kDa |
Unconjugated | |
90% | |
56.4 kDa | |
Mouse Angiopoietin-2, His Tag (orb1496268) is expressed from CHO cells. It contains AA Tyr 19 - Phe 496 (Accession # O35608-1). |
Unconjugated | |
90% | |
27.1 kDa | |
Mouse Angiopoietin-2, His Tag (orb1496316) is expressed from human 293 cells (HEK293). It contains AA Lys 275 - Phe 496 (Accession # O35608-1). |
Unconjugated | |
90% | |
56.5 kDa | |
Mouse Angiopoietin-2, His Tag (orb759210) is expressed from human 293 cells (HEK293). It contains AA Tyr 19 - Phe 496 (Accession # O35608-1). |
Filter by Rating