You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb623810 |
---|---|
Category | Antibodies |
Description | MORC3 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human MORC3 (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 120 kDa |
UniProt ID | Q14149 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | MORC family CW-type zinc finger protein 3; Nuclear Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis using anti-MORC3 antibody.Lane 1:rat heart tissue, Lane 2:rat liver tissue, Lane 3:mouse heart tissue.
IHC analysis of MORC3 using anti-MORC3 antibody.
IHC analysis of MORC3 using anti-MORC3 antibody.
IF analysis of MORC3 using anti-MORC3 antibody.
Flow Cytometry analysis of A431 cells using anti-MORC3 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.
WB | |
Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating