You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb315172 |
---|---|
Category | Antibodies |
Description | Monoamine Oxidase A/MAOA Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 59682 MW |
UniProt ID | P21397 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Amine oxidase [flavin-containing] A;1.4.3.4;Monoam Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U87 cells using anti-MAOA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of U20S cells using anti-MAOA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of MAOA using anti-MAOA antibody.Lane 1:human RT4 cell;2:human HepG2 cell;3:rat liver tissue;4:mouse liver tissue.
IF analysis of MAOA using anti-MAOA antibody. MAOA was detected in immunocytochemical section of U20S cells.
IHC analysis of MAOA using anti-MAOA antibody. MAOA was detected in a paraffin-embedded section of mouse cardiac muscle tissue.
IHC analysis of MAOA using anti-MAOA antibody. MAOA was detected in a paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of MAOA using anti-MAOA antibody. MAOA was detected in a paraffin-embedded section of rat cardiac muscle tissue.
IHC, WB | |
Bovine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating