You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358990 |
---|---|
Category | Proteins |
Description | Recombinant monkey IL4 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 96% as determined by SDS-PAGE and HPLC. |
MW | 14.9 kDa |
UniProt ID | P51492 |
Protein Sequence | HNCHIALREIIETLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS |
Protein Length | Full Length of Mature Protein |
Source | E.Coli |
Biological Origin | Macaca mulatta (Rhesus macaque) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0 × 106 IU/mg. |
Expression Region | 25-153aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered 2 × PBS, pH 7.4, 5 % trehalose |
Alternative names | B cell growth factor 1 protein, B cell IgG differe Read more... |
Background | Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes (By similarity). {ECO:0000250}. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
SDS-PAGE analysis of Monkey IL4 protein (Active)
Filter by Rating